SAR1 (SAR1A) (NM_020150) Human Recombinant Protein

CAT#: TP301450M

Recombinant protein of human SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 2, 100 µg

Product Images

Coomassie blue staining of purified SAR1A protein (Cat# TP301450). The protein was produced from HEK293T cells transfected with SAR1A cDNA clone (Cat# RC201450) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201450 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT
  FTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTD
  AISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064535
• Locus ID: 56681
• UniProt ID: Q9NR31, Q5SQT9
• Cytogenetics: 10q22.1
• Refseq Size: 3018
• Refseq ORF: 594
• Synonyms: masra2; SAR1; Sara; SARA1
• Summary: Involved in transport from the endoplasmic reticulum to the Golgi apparatus (By similarity). Required to maintain SEC16A localization at discrete locations on the ER membrane perhaps by preventing its dissociation. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining endoplasmic reticulum exit sites (ERES).[UniProtKB/Swiss-Prot Function]