SSH3BP1 (ABI1) (NM_001012752) Human Recombinant Protein

  • Product Brand Image
SKU
TP301264
Recombinant protein of human abl-interactor 1 (ABI1), transcript variant 4, 20 µg
In Control Promo
  $867.00
4 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201264 protein sequence
Red=Cloning site Green=Tags(s)

MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALAN
NVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKP
IDYTVLDDVGHGVKHGNNQPARTGTLSRTNPPTQKPPSPPMSGRGTLGRNTPYKTLEPVKPPTVPNDYMT
SPARLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYG
TMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFV
ARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVDYEDEEAAVVQYNDPYADGDPAWAPKNYIEKVV
AIYDYTKDKDDELSFMEGAIIYVIKKNDDGWYEGVCNRVTGLFPGNYVESIMHYTD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001012770
Locus ID 10006
UniProt ID Q8IZP0
Cytogenetics 10p12.1
RefSeq Size 3629
RefSeq ORF 1428
Synonyms ABI-1; ABLBP4; E3B1; NAP1BP; SSH3BP; SSH3BP1
Summary This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14. provided by RefSeq, Sep 2011
Protein Categories Intracellular Proteins
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "SSH3BP1" proteins (16)
SKU Description Size Price
PH301264 ABI1 MS Standard C13 and N15-labeled recombinant protein (NP_001012770) 10 ug
$3,360.00
PH317707 ABI1 MS Standard C13 and N15-labeled recombinant protein (NP_005461) 10 ug
$3,360.00
LC401677 ABI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422826 ABI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422828 ABI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432894 ABI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433150 ABI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433176 ABI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401677 Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 1 100 ug
$665.00
LY422826 Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 2 100 ug
$665.00
LY422828 Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 4 100 ug
$436.00
LY432894 Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 12 100 ug
$436.00
LY433150 Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 6 100 ug
$436.00
LY433176 Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 5 100 ug
$436.00
TP317707 Recombinant protein of human abl-interactor 1 (ABI1), transcript variant 1, 20 µg 20 ug
$867.00
TP329894 Purified recombinant protein of Homo sapiens abl-interactor 1 (ABI1), transcript variant 12, 20 µg 20 ug
$867.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.