ZNF593 (NM_015871) Human Recombinant Protein

SKU TP301028L

Recombinant protein of human zinc finger protein 593 (ZNF593), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201028 protein sequence; Red=Cloning site Green=Tags(s); ; MKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKR; LKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_056955
• Locus ID: 51042
• UniProt ID: O00488
• Cytogenetics: 1p36.11
• RefSeq Size: 653
• RefSeq ORF: 348
• Synonyms: ZT86
• Summary: Negatively modulates the DNA binding activity of Oct-2 and therefore its transcriptional regulatory activity. Could act either by binding to DNA octamer or by interacting with Oct-2. May also be a modulator of other octamer-binding proteins.[UniProtKB/Swiss-Prot Function]
• Protein Families: Stem cell - Pluripotency, Transcription Factors