PCLAF (NM_014736) Human Recombinant Protein

CAT#: TP300694L

Recombinant protein of human KIAA0101 (KIAA0101), transcript variant 1, 1 mg

Product Images

Coomassie blue staining of purified PCLAF protein (Cat# TP300694). The protein was produced from HEK293T cells transfected with PCLAF cDNA clone (Cat# RC200694) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200694 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFR
  LSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055551
• Locus ID: 9768
• UniProt ID: Q15004
• Cytogenetics: 15q22.31
• Refseq Size: 1515
• Refseq ORF: 333
• Synonyms: KIAA0101; L5; NS5ATP9; OEATC; OEATC-1; OEATC1; p15(PAF); p15/PAF; p15PAF; PAF; PAF15
• Summary: PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome