FKBP1B (NM_054033) Human Recombinant Protein

CAT#: TP300667L

Recombinant protein of human FK506 binding protein 1B, 12.6 kDa (FKBP1B), transcript variant 2, 1 mg

Product Images

Coomassie blue staining of purified FKBP1B protein (Cat# TP300667). The protein was produced from HEK293T cells transfected with FKBP1B cDNA clone (Cat# RC200667) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200667 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPL
  SPLPICPHPC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_473374
• Locus ID: 2281
• UniProt ID: P68106
• Cytogenetics: 2p23.3
• Refseq Size: 1016
• Refseq ORF: 240
• Synonyms: FKBP1L; FKBP12.6; OTK4; PKBP1L; PPIase
• Summary: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome