RPP20 (POP7) (NM_005837) Human Recombinant Protein

CAT#: TP300582L

Recombinant protein of human processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae) (POP7), 1 mg

Product Images

Coomassie blue staining of purified POP7 protein (Cat# TP300582). The protein was produced from HEK293T cells transfected with POP7 cDNA clone (Cat# RC200582) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200582 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIY
  IHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-Myc/DDK
• Predicted MW: 15.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005828
• Locus ID: 10248
• UniProt ID: O75817
• Cytogenetics: 7q22.1
• Refseq Size: 949
• Refseq ORF: 420
• Synonyms: 0610037N12Rik; RPP2; RPP20
• Summary: Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends (PubMed:9630247, PubMed:30454648). Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences (PubMed:28115465).[UniProtKB/Swiss-Prot Function]
• Protein Families: Stem cell - Pluripotency