DDX5 (NM_004396) Human Recombinant Protein

CAT#: TP300371L

Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 1 mg

Product Images

DDX5 binds to resveratrol regardless of the digestion of RNA by RNase A treatment. Purified recombinant DDX5 (1 ug) (OriGene TP300371) with or without RNase A treatment was incubated with the resveratrol-immobilized beads, and the bound DDX5 was detected by Western blotting. The input lane corresponds to recombinant DDX5 protein (150 ng). Figure cited from Cell Death Dis, PMID: 27148684

• 

  Coomassie blue staining of purified DDX5 protein (Cat# TP300371). The protein was produced from HEK293T cells transfected with DDX5 cDNA clone (Cat# RC200371) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200371 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTA
  QEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQT
  GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQ
  IRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSA
  TWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVET
  KRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN
  SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMK
  DDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRT
  GNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 69 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Phosphorylation substrate (PMID: 25649741)
  Binding assay (PMID: 27148684)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004387
• Locus ID: 1655
• UniProt ID: P17844
• Cytogenetics: 17q23.3
• Refseq Size: 3769
• Refseq ORF: 1842
• Synonyms: G17P1; HLR1; HUMP68; p68
• Summary: This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of splicing, and in the processing of small noncoding RNAs. Members of this family contain nine conserved motifs, including the conserved Asp-Glu-Ala-Asp (DEAD) motif, important to ATP binding and hydrolysis as well as RNA binding and unwinding activities. Dysregulation of this gene may play a role in cancer development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2017]
• Protein Pathways: Spliceosome