FAM50A (NM_004699) Human Recombinant Protein

CAT#: TP300370L

Recombinant protein of human family with sequence similarity 50, member A (FAM50A), 1 mg

Product Images

Coomassie blue staining of purified FAM50A protein (Cat# TP300370). The protein was produced from HEK293T cells transfected with FAM50A cDNA clone (Cat# RC200370) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200370 representing NM_004699
  Red=Cloning site Green=Tags(s)
  
  MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTL
  NDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMY
  EEEMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSG
  HRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLF
  NFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004690
• Locus ID: 9130
• UniProt ID: Q14320
• Cytogenetics: Xq28
• Refseq Size: 1311
• Refseq ORF: 1017
• Synonyms: 9F; DXS9928E; HXC-26; HXC26; MRXSA; XAP5
• Summary: This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. [provided by RefSeq, Sep 2009]