ROC1 (RBX1) (NM_014248) Human Recombinant Protein

CAT#: TP300348

Recombinant protein of human ring-box 1 (RBX1), 20 µg

Product Images

Coomassie blue staining of purified RBX1 protein (Cat# TP300348). The protein was produced from HEK293T cells transfected with RBX1 cDNA clone (Cat# RC200348) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200348 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTV
  AWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055063
• Locus ID: 9978
• UniProt ID: P62877
• Cytogenetics: 22q13.2
• Refseq Size: 906
• Refseq ORF: 324
• Synonyms: BA554C12.1; RNF75; ROC1
• Summary: This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.[provided by RefSeq, Sep 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Nucleotide excision repair, Oocyte meiosis, Pathways in cancer, Renal cell carcinoma, TGF-beta signaling pathway, Ubiquitin mediated proteolysis, Wnt signaling pathway