Angiopoietin like 7 (ANGPTL7) (NM_021146) Human Recombinant Protein

CAT#: TP300321L

Recombinant protein of human angiopoietin-like 7 (ANGPTL7), 1 mg

Product Images

Coomassie blue staining of purified ANGPTL7 protein (Cat# TP300321). The protein was produced from HEK293T cells transfected with ANGPTL7 cDNA clone (Cat# RC200321) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200321 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQ
  ERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYR
  ISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIH
  RLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDN
  CLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_066969
• Locus ID: 10218
• UniProt ID: O43827
• Cytogenetics: 1p36.22
• Refseq Size: 2307
• Refseq ORF: 1038
• Synonyms: AngX; CDT6; dJ647M16.1
• Summary: Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous humor and for the maintenance of intraocular pressure (PubMed:21199193). Is a negative regulator of angiogenesis in the cornea, and plays a major role in maintaining corneal avascularity and transparency (PubMed:25622036).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane