PIMREG (NM_019013) Human Recombinant Protein

CAT#: TP300148L

Recombinant protein of human family with sequence similarity 64, member A (FAM64A), 1 mg

Product Images

Coomassie blue staining of purified PIMREG protein (Cat# TP300148). The protein was produced from HEK293T cells transfected with PIMREG cDNA clone (Cat# RC200148) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200148 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWK
  RLETPEPGQQGLQAAARSAKSALGAVSQRIQESCQSGTKWLVETQVKARRRKRGAQKGSGSPTHSLSQKS
  TRLSGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGI
  QHLQKLSQELDEAIMAEESGDIVSLIHD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061886
• Locus ID: 54478
• UniProt ID: Q9BSJ6, A0A0S2Z5C7
• Cytogenetics: 17p13.2
• Refseq Size: 1563
• Refseq ORF: 714
• Synonyms: CATS; FAM64A; RCS1
• Summary: During mitosis, may play a role in the control of metaphase-to-anaphase transition.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome