TMEM38B (NM_018112) Human Recombinant Protein

CAT#: TP300137L

Recombinant protein of human transmembrane protein 38B (TMEM38B), 1 mg

Product Images

Coomassie blue staining of purified TMEM38B protein (Cat# TP300137). The protein was produced from HEK293T cells transfected with TMEM38B cDNA clone (Cat# RC200137) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200137 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSPWDELALAFSRTSMFPFFDIAHYLVSVMAVKRQPGAAALAWKNPISSWFTAMLHCFGGGILSCLLLA
  EPPLKFLANHTNILLASSIWYITFFCPHDLVSQGYSYLPVQLLASGMKEVTRTWKIVGGVTHANSYYKNG
  WIVMIAIGWARGAGGTIITNFERLVKGDWKPEGDEWLKMSYPAKVTLLGSVIFTFQHTQHLAISKHNLMF
  LYTIFIVATKITMMTTQTSTMTFAPFEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASD
  NVKKKHTKKNE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060582
• Locus ID: 55151
• UniProt ID: Q9NVV0
• Cytogenetics: 9q31.2
• Refseq Size: 3558
• Refseq ORF: 873
• Synonyms: bA219P18.1; C9orf87; D4Ertd89e; OI14; TRIC-B; TRICB
• Summary: This gene encodes an intracellular monovalent cation channel that functions in maintenance of intracellular calcium release. Mutations in this gene may be associated with autosomal recessive osteogenesis. [provided by RefSeq, Oct 2012]
• Protein Families: Transmembrane