METTL11A (NTMT1) (NM_014064) Human Recombinant Protein

CAT#: TP300055L

Recombinant protein of human methyltransferase like 11A (METTL11A), 1 mg

Product Images

Coomassie blue staining of purified NTMT1 protein (Cat# TP300055). The protein was produced from HEK293T cells transfected with NTMT1 cDNA clone (Cat# RC200055) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200055 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGA
  GIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGH
  LTDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENL
  PDEIYHVYSFALR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_054783
• Locus ID: 28989
• UniProt ID: Q9BV86, A0A024R8E4
• Cytogenetics: 9q34.11
• Refseq Size: 1536
• Refseq ORF: 669
• Synonyms: AD-003; C9orf32; HOMT1A; METTL11A; NRMT; NRMT1; NTM1A
• Summary: The METTL11A gene encodes an N-terminal methyltransferase for the RAN (MIM 601179) guanine nucleotide exchange factor regulator of chromosome condensation 1 (RCC1; MIM 179710). METTL11A enzyme alpha-N-methylates other protein targets such as SET (MIM 600960) and RB (MIM 180200).[supplied by OMIM, Nov 2010]
• Protein Families: Druggable Genome