VEGFR-1 / Flt-1 (D1-D3) Human Protein

CAT#: DA3541X

Reviews ()
Write a review

VEGFR-1 / Flt-1 (D1-D3) human recombinant protein, 20 µg



USD 310.00


Availability*
2 Weeks

Size
    • 20 ug


Product images

Specifications

Product Data
Description VEGFR-1 / Flt-1 (D1-D3) human recombinant protein, 20 µg
Species Human
Expression Host Insect
Expression cDNA Clone or AA Sequence SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSY
Predicted MW 45 kDa
Purity >90% by SDS-PAGE and visualised by silver stain
Buffer Presentation State: Purified
State: Lyophilized protein
Buffer System: PBS
Stabilizer: None
Bioactivity Biological: The activity of sVEGFR-1 (D1-3) was determined by its ability to abolish the binding of iodinated VEGF to solid surfaces or cell surfaces receptors, and in Far-Western and cross-linking experiments with iodinated VEGF. 
Measured by its ability to inhibit the VEGF165-induced proliferation in human umbilical vein endothelial (HUVE) cells.
Specific: 2.5 x 10e5 units/mg
Endotoxin < 0.1 ng per µg of VEGF.
Reconstitution The lyophilized sVEGFR-1D1-3 is soluble in water and most aqueous buffers and should be restore in PBS to a concentration of 100 ng/ml.
Preparation Lyophilized protein
Protein Description Recombinant human soluble Vascular Endothelial Growth Factor Receptor-1 domain D1-3 (sVEGFR-1D1-3) is produced as a non-chimeric protein in a monomeric form. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF. The receptor monomers have a mass of approximately 45 kDa containing 327 amino acid residues.
Note Centrifuge vials before opening!
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_001153392
Locus ID 2321
Cytogenetics 13q12.3
Synonyms FLT; FLT-1; VEGFR-1; VEGFR1
Summary This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.[provided by RefSeq, May 2009]
Protein Families Druggable Genome, Protein Kinase, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, Endocytosis, Focal adhesion

Documents

Other products for "FLT1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools