EGF

CAT#: AR31147PU-N

Reviews ()
Write a review

Recombinant Human Epidermal Growth Factor (EGF).


 Product Datasheet for 'AR31147PU-N'

  View other "EGF" proteins (11)

USD 230.00


Availability*
2 Weeks

Size
    • 500 ug


Product images

Specifications

Product Data
Description Recombinant Human Epidermal Growth Factor (EGF).
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKW WELR.
N-terminal Sequence: MNSDSECPLS
Tag Tag Free
Predicted MW 6.35 kDa
Purity > 95 % by SDS-PAGE & silver stain
Buffer PBS
Bioactivity The biological activity was determined by the ability to induce EGF receptor phosphorylation in the A431 tumor cell line [Soler et al, J Chromatography B, 788, 2003] and the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
Reconstitution A quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml.
This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use.
Preparation Sterile, Lyophilized powder.
Reference Data
RefSeq NP_001171601
Locus ID 1950
Cytogenetics 4q25
Synonyms HOMG4; URG
Summary This gene encodes a member of the epidermal growth factor superfamily. The encoded preproprotein is proteolytically processed to generate the 53-amino acid epidermal growth factor peptide. This protein acts a potent mitogenic factor that plays an important role in the growth, proliferation and differentiation of numerous cell types. This protein acts by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are the cause of hypomagnesemia type 4. Dysregulation of this gene has been associated with the growth and progression of certain cancers. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]
Protein Families Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transmembrane
Protein Pathways Bladder cancer, Cytokine-cytokine receptor interaction, Endocytosis, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Gap junction, Glioma, MAPK signaling pathway, Melanoma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton

Documents

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones