MTFR1 (NM_001145838) Human Mass Spec Standard

CAT#: PH327926

MTFR1 MS Standard C13 and N15-labeled recombinant protein (NP_001139310)

Product Images

Coomassie blue staining of purified MTFR1 protein (Cat# TP327926). The protein was produced from HEK293T cells transfected with MTFR1 cDNA clone (Cat# RC227926) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227926
• Predicted MW: 33 kDa
• Protein Sequence:
  Sequence Link

  >RC227926 representing NM_001145838
  Red=Cloning site Green=Tags(s)
  
  MLGWIKRLIRMVFQQVGVSMQSINSHATEWSPSHPGEDAVASFADVGWVAKEEGECSARLRTEVRSRPPL
  QDDLLFFEKAPSRQISLPDLSQEEPQLKTPALANEEALQKICALENELAALRAQIAKIVTQQEQQNLTAG
  DLDSTTFGTIPPHPPPPPPPLPPPALGLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILK
  EMNSVKLRSVKRSEQDVKPKPVDATDPAALIAEALKKKFAYRYRSDSQDEVEKGIPKSESEATSERVLFG
  PHMLKPTGKMKALIENVSDS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001139310
• RefSeq ORF: 900
• Synonyms: CHPPR; FAM54A2
• Locus ID: 9650
• UniProt ID: Q15390
• Cytogenetics: 8q13.1
• Summary: This gene encodes a mitochondrial protein that is characterized by a poly-proline rich region. A chicken homolog of this protein promotes mitochondrial fission and the mouse homolog protects cells from oxidative stress. A related pseudogene of this gene is found on chromosome X. [provided by RefSeq, Mar 2009]