SERPINB2 (NM_001143818) Human Mass Spec Standard

CAT#: PH327583

SERPINB2 MS Standard C13 and N15-labeled recombinant protein (NP_001137290)

Product Images

Coomassie blue staining of purified SERPINB2 protein (Cat# TP327583). The protein was produced from HEK293T cells transfected with SERPINB2 cDNA clone (Cat# RC227583) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227583
• Predicted MW: 46.6 kDa
• Protein Sequence:
  Sequence Link

  >RC227583 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTP
  MTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREE
  YIRLCQKYYSSEPQAVDFLECAEEARKKIYSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKT
  PFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLE
  LLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLF
  LSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001137290
• RefSeq Size: 2180
• RefSeq ORF: 1245
• Synonyms: HsT1201; PAI; PAI-2; PAI2; PLANH2
• Locus ID: 5055
• UniProt ID: P05120
• Cytogenetics: 18q21.33-q22.1
• Summary: Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Secreted Protein