Parvin gamma (PARVG) (NM_001137605) Human Mass Spec Standard
CAT#: PH326988
PARVG MS Standard C13 and N15-labeled recombinant protein (NP_001131077)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226988 |
Predicted MW | 37.5 kDa |
Protein Sequence |
>RC226988 protein sequence
Red=Cloning site Green=Tags(s) MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEE DMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTL HLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVN AVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALE LLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001131077 |
RefSeq Size | 3475 |
RefSeq ORF | 993 |
Locus ID | 64098 |
UniProt ID | Q9HBI0, A0A024R4U4 |
Cytogenetics | 22q13.31 |
Summary | Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.[supplied by OMIM, Aug 2004] |
Protein Pathways | Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Tight junction, Vibrio cholerae infection, Viral myocarditis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411746 | PARVG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427944 | PARVG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427945 | PARVG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411746 | Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 1 |
USD 436.00 |
|
LY427944 | Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 2 |
USD 436.00 |
|
LY427945 | Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 3 |
USD 436.00 |
|
PH306755 | PARVG MS Standard C13 and N15-labeled recombinant protein (NP_071424) |
USD 3,255.00 |
|
PH327051 | PARVG MS Standard C13 and N15-labeled recombinant protein (NP_001131078) |
USD 3,255.00 |
|
TP306755 | Recombinant protein of human parvin, gamma (PARVG), transcript variant 1, 20 µg |
USD 867.00 |
|
TP326988 | Recombinant protein of human parvin, gamma (PARVG), transcript variant 2, 20 µg |
USD 867.00 |
|
TP327051 | Recombinant protein of human parvin, gamma (PARVG), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review