PSD93 (DLG2) (NM_001142702) Human Mass Spec Standard

SKU
PH326876
DLG2 MS Standard C13 and N15-labeled recombinant protein (NP_001136174)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226876]
Predicted MW 38.2 kDa
Protein Sequence
Protein Sequence
>RC226876 representing NM_001142702
Red=Cloning site Green=Tags(s)

MMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEG
DSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGDIPGLGDDGYGTKTLRGQEDLILSYEPVTRQE
INYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIE
AGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPRSLEPLMEMNKRLTEEQA
KKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001136174
RefSeq ORF 1002
Synonyms chapsyn-110; PPP1R58; PSD-93; PSD93
Locus ID 1740
UniProt ID Q15700
Cytogenetics 11q14.1
Summary This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. The encoded protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described, but their full-length nature is not known. [provided by RefSeq, Dec 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PSD93 (DLG2) (NM_001142702) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC428249 DLG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428251 DLG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY428249 Transient overexpression lysate of discs, large homolog 2 (Drosophila) (DLG2), transcript variant 1 100 ug
$665.00
LY428251 Transient overexpression lysate of discs, large homolog 2 (Drosophila) (DLG2), transcript variant 4 100 ug
$436.00
TP326876 Recombinant protein of human discs, large homolog 2 (Drosophila) (DLG2), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761236 Purified recombinant protein of Human discs, large homolog 2 (Drosophila) (DLG2), transcript variant 4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.