Clathrin light chain (CLTB) (NM_007097) Human Mass Spec Standard
CAT#: PH324622
CLTB MS Standard C13 and N15-labeled recombinant protein (NP_009028)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224622 |
Predicted MW | 25 kDa |
Protein Sequence |
>RC224622 representing NM_007097
Red=Cloning site Green=Tags(s) MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGT TVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWN QRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCK DVSRLRSVLMSLKQTPLSR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_009028 |
RefSeq Size | 1184 |
RefSeq ORF | 687 |
Synonyms | LCB |
Locus ID | 1212 |
UniProt ID | P09497 |
Cytogenetics | 5q35.2 |
Summary | Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Pathways | Endocytosis, Huntington's disease, Lysosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400697 | CLTB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC416210 | CLTB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400697 | Transient overexpression lysate of clathrin, light chain (Lcb) (CLTB), transcript variant 1 |
USD 436.00 |
|
LY416210 | Transient overexpression lysate of clathrin, light chain (Lcb) (CLTB), transcript variant 2 |
USD 436.00 |
|
TP324622 | Recombinant protein of human clathrin, light chain (Lcb) (CLTB), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review