QK1 (QKI) (NM_206853) Human Mass Spec Standard
CAT#: PH324090
QKI MS Standard C13 and N15-labeled recombinant protein (NP_996735)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224090 |
Predicted MW | 35 kDa |
Protein Sequence |
>RC224090 representing NM_206853
Red=Cloning site Green=Tags(s) MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSA ELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRG KPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIK SPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPE AGLIYTPYEYPYTLAPATSILEYPIEPSGVLGMAFPTKG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_996735 |
RefSeq Size | 5693 |
RefSeq ORF | 957 |
Synonyms | Hqk; hqkI; QK; QK1; QK3 |
Locus ID | 9444 |
UniProt ID | Q96PU8, Q8WY44 |
Cytogenetics | 6q26 |
Summary | The protein encoded by this gene is an RNA-binding protein that regulates pre-mRNA splicing, export of mRNAs from the nucleus, protein translation, and mRNA stability. The encoded protein is involved in myelinization and oligodendrocyte differentiation and may play a role in schizophrenia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402025 | QKI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC403718 | QKI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC403730 | QKI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC403731 | QKI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402025 | Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 1 |
USD 436.00 |
|
LY403718 | Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 4 |
USD 436.00 |
|
LY403730 | Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 2 |
USD 436.00 |
|
LY403731 | Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 3 |
USD 436.00 |
|
PH305779 | QKI MS Standard C13 and N15-labeled recombinant protein (NP_006766) |
USD 3,255.00 |
|
PH315734 | QKI MS Standard C13 and N15-labeled recombinant protein (NP_996736) |
USD 3,255.00 |
|
PH315788 | QKI MS Standard C13 and N15-labeled recombinant protein (NP_996737) |
USD 3,255.00 |
|
TP305779 | Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 1, 20 µg |
USD 867.00 |
|
TP315734 | Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 3, 20 µg |
USD 867.00 |
|
TP315788 | Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 4, 20 µg |
USD 867.00 |
|
TP324090 | Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review