METTL21D (VCPKMT) (NM_024558) Human Mass Spec Standard

CAT#: PH323670

C14orf138 MS Standard C13 and N15-labeled recombinant protein (NP_078834)

Product Images

Coomassie blue staining of purified VCPKMT protein (Cat# TP323670). The protein was produced from HEK293T cells transfected with VCPKMT cDNA clone (Cat# RC223670) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223670
• Predicted MW: 25.6 kDa
• Protein Sequence:
  Sequence Link

  >RC223670 representing NM_024558
  Red=Cloning site Green=Tags(s)
  
  MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRS
  VLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFI
  LMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEY
  RSEDIHIIYIRKKKSKFPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_078834
• RefSeq Size: 1784
• RefSeq ORF: 687
• Synonyms: C14orf138; METTL21D; VCP-KMT
• Locus ID: 79609
• UniProt ID: Q9H867
• Cytogenetics: 14q21.3
• Summary: Protein-lysine N-methyltransferase that specifically trimethylates 'Lys-315' of VCP/p97; this modification may decrease VCP ATPase activity.[UniProtKB/Swiss-Prot Function]