RNF14 (NM_183401) Human Mass Spec Standard

SKU
PH323420
RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899648)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223420]
Predicted MW 53.8 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC223420
Blue=ORF Red=Cloning site Green=Tag(s)

MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICF
LPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYL
NIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQA
QQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATP
GQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYH
GVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKL
DGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED

myc-FLAG tag

Recombinant protein using RC223420 also available, TP323420
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_899648
RefSeq Size 4201
RefSeq ORF 1424
Synonyms ARA54; HFB30; HRIHFB2038; TRIAD2
Locus ID 9604
UniProt ID Q9UBS8
Cytogenetics 5q31.3
Summary The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq, Jan 2011]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:RNF14 (NM_183401) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323304 RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_004281) 10 ug
$3,255.00
PH323362 RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899647) 10 ug
$3,255.00
PH323491 RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899646) 10 ug
$3,255.00
LC405271 RNF14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405271 Transient overexpression lysate of ring finger protein 14 (RNF14), transcript variant 4 100 ug
$665.00
TP323304 Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323362 Recombinant protein of human ring finger protein 14 (RNF14), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323420 Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323491 Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.