RNF14 (NM_183400) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC223362] |
Predicted MW | 53.7 kDa |
Protein Sequence |
Protein Sequence
>RC223362 representing NM_183400
Red=Cloning site Green=Tags(s) MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFL PPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNI VSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQI KCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVK ELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPC KVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKM TCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_899647 |
RefSeq Size | 2970 |
RefSeq ORF | 1422 |
Synonyms | ARA54; HFB30; HRIHFB2038; TRIAD2 |
Locus ID | 9604 |
UniProt ID | Q9UBS8 |
Cytogenetics | 5q31.3 |
Summary | The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome, Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH323304 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_004281) | 10 ug |
$3,255.00
|
|
PH323420 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899648) | 10 ug |
$3,255.00
|
|
PH323491 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899646) | 10 ug |
$3,255.00
|
|
LC405271 | RNF14 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY405271 | Transient overexpression lysate of ring finger protein 14 (RNF14), transcript variant 4 | 100 ug |
$665.00
|
|
TP323304 | Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323362 | Recombinant protein of human ring finger protein 14 (RNF14), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323420 | Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 5, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323491 | Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.