SLC25A3 (NM_005888) Human Mass Spec Standard

CAT#: PH322824

SLC25A3 MS Standard C13 and N15-labeled recombinant protein (NP_005879)

Product Images

Coomassie blue staining of purified SLC25A3 protein (Cat# TP322824). The protein was produced from HEK293T cells transfected with SLC25A3 cDNA clone (Cat# RC222824) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222824
• Predicted MW: 40.09 kDa
• Protein Sequence:
  Sequence Link

  >RC222824 representing NM_005888
  Red=Cloning site Green=Tags(s)
  
  MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGSGRFFILCGL
  GGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGF
  YEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKE
  EGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIV
  SHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM
  PESLKKKLGLTQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005879
• RefSeq Size: 1688
• RefSeq ORF: 1086
• Synonyms: OK/SW-cl.48; PHC; PTP
• Locus ID: 5250
• UniProt ID: Q00325, A0A024RBH9, Q6MZF9
• Cytogenetics: 12q23.1
• Summary: The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane