SMYD1 (NM_198274) Human Mass Spec Standard

CAT#: PH321269

SMYD1 MS Standard C13 and N15-labeled recombinant protein (NP_938015)

Product Images

Coomassie blue staining of purified SMYD1 protein (Cat# TP321269). The protein was produced from HEK293T cells transfected with SMYD1 cDNA clone (Cat# RC221269) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221269
• Predicted MW: 56.6 kDa
• Protein Sequence:
  Sequence Link

  >RC221269 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTIGRMENVEVFTAEGKGRGLKATKEFWAADIIFAERAYSAVVFDSLVNFVCHTCFKRQEKLHRCGQCKF
  AHYCDRTCQKDAWLNHKNECSAIKRYGKVPNENIRLAARIMWRVEREGTGLTEGCLVSVDDLQNHVEHFG
  EEEQKDLRVDVDTFLQYWPPQSQQFSMQYISHIFGVINCNGFTLSDQRGLQAVGVGIFPNLGLVNHDCWP
  NCTVIFNNGNHEAVKSMFHTQMRIELRALGKISEGEELTVSYIDFLNVSEERKRQLKKQYYFDCTCEHCQ
  KKLKDDLFLGVKDNPKPSQEVVKEMIQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQEPVFADTNIYM
  LRMLSIVSEVLSYLQAFEEASFYARRMVDGYMKLYHPNNAQLGMAVMRAGLTNWHAGNIEVGHGMICKAY
  AILLVTHGPSHPITKDLEAMRVQTEMELRMFRQNEFMYYKMREAALNNQPMQVMAEPSNEPSPALFHKKQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_938015
• RefSeq Size: 4441
• RefSeq ORF: 1470
• Synonyms: BOP; KMT3D; ZMYND18; ZMYND22
• Locus ID: 150572
• UniProt ID: Q8NB12, Q5HYE8
• Cytogenetics: 2p11.2
• Summary: Methylates histone H3 at 'Lys-4' (H3K4me), seems able to perform both mono-, di-, and trimethylation. Acts as a transcriptional repressor. Essential for cardiomyocyte differentiation and cardiac morphogenesis.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome