Bestrophin 3 (BEST3) (NM_152439) Human Mass Spec Standard
CAT#: PH318436
BEST3 MS Standard C13 and N15-labeled recombinant protein (NP_689652)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218436 |
Predicted MW | 50.8 kDa |
Protein Sequence |
>RC218436 representing NM_152439
Red=Cloning site Green=Tags(s) MTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGI PLVYTQVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAAD YCIPSFLGSTVQMGLSGSDFPDEEWLWDYEKHGHRHSMIRRVKRFLSAHEHPSSPRRRSYRRQTSDSSMF LPRDDLSPARDLLDVPSRNPPRASPTWKKSCFPEGSPTLHFSMGELSTIRETSQTSTLQSLTPQSSVRTS PIKMPLVPEVLITAAEAPVPTSGGYHHDSATSILSSEFTGVQPSKTEQQQGPMGSILSPSEKETPPGGPS PQTVSASAEENIFNCEEDPGDTFLKRWSLPGFLGSSHTSLGNLSPDPMSSQPALLIDTETSSEISGINIV AGSRVSSDMLYLMENLDTKETDIIELNKETEESPK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_689652 |
RefSeq Size | 2898 |
RefSeq ORF | 1365 |
Synonyms | VMD2L3 |
Locus ID | 144453 |
UniProt ID | Q8N1M1 |
Cytogenetics | 12q15 |
Summary | BEST3 belongs to the bestrophin family of anion channels, which includes BEST1 (MIM 607854), the gene mutant in vitelliform macular dystrophy (VMD; MIM 153700), and 2 other BEST1-like genes, BEST2 (MIM 607335) and BEST4 (MIM 607336). Bestrophins are transmembrane (TM) proteins that share a homology region containing a high content of aromatic residues, including an invariant arg-phe-pro (RFP) motif. The bestrophin genes share a conserved gene structure, with almost identical sizes of the 8 RFP-TM domain-encoding exons and highly conserved exon-intron boundaries. Each of the 4 bestrophin genes has a unique 3-prime end of variable length (Stohr et al., 2002 [PubMed 12032738]; Tsunenari et al., 2003 [PubMed 12907679]).[supplied by OMIM, Mar 2008] |
Protein Families | Ion Channels: Other, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407540 | BEST3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC409969 | BEST3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY407540 | Transient overexpression lysate of bestrophin 3 (BEST3), transcript variant 2 |
USD 665.00 |
|
LY409969 | Transient overexpression lysate of bestrophin 3 (BEST3), transcript variant 1 |
USD 665.00 |
|
TP318436 | Recombinant protein of human bestrophin 3 (BEST3), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review