CAMK2A (NM_015981) Human Mass Spec Standard
CAT#: PH318186
CAMK2A MS Standard C13 and N15-labeled recombinant protein (NP_057065)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218186 |
Predicted MW | 55.1 kDa |
Protein Sequence |
>RC218186 representing NM_015981
Red=Cloning site Green=Tags(s) MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHP NIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPEN LLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGY PPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASC MHRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIE DEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057065 |
RefSeq Size | 4836 |
RefSeq ORF | 1467 |
Synonyms | CAMKA; CaMKIIalpha; CaMKIINalpha; MRD53; MRT63 |
Locus ID | 815 |
UniProt ID | A8K161, Q8IWE0 |
Cytogenetics | 5q32 |
Summary | The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Several transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jun 2018] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406882 | CAMK2A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406882 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 2 |
USD 436.00 |
|
PH305202 | CAMK2A MS Standard C13 and N15-labeled recombinant protein (NP_741960) |
USD 3,255.00 |
|
TP305202 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 2, 20 µg |
USD 867.00 |
|
TP318186 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review