SIAT4A (ST3GAL1) (NM_003033) Human Mass Spec Standard

CAT#: PH317696

ST3GAL1 MS Standard C13 and N15-labeled recombinant protein (NP_003024)

Product Images

Coomassie blue staining of purified ST3GAL1 protein (Cat# TP317696). The protein was produced from HEK293T cells transfected with ST3GAL1 cDNA clone (Cat# RC217696) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217696
• Predicted MW: 39.1 kDa
• Protein Sequence:
  Sequence Link

  >RC217696 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENLKRLIKHRPCTCTHCIGQRKL
  SAWFDERFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKELFRVVPGNVDPMLEKRSVGCR
  RCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEADVGTKTTHHLVYPESFRELGDNVSMILVPFK
  TIDLEWVVSAITTGTISHTYIPVPAKIRVKQDKILIYHPAFIKYVFDNWLQGHGRYPSTGILSVIFSMHV
  CDEVDLYGFGADSKGNWHHYWENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003024
• RefSeq Size: 6971
• RefSeq ORF: 1020
• Synonyms: 1; Gal-NAc6S; SIAT4A; SIATFL; ST3GalA; ST3GalA.1; ST3GalIA; ST3O
• Locus ID: 6482
• UniProt ID: Q11201, A0A024R9L6
• Cytogenetics: 8q24.22
• Summary: The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of the encoded protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B. Two transcript variants encoding the same protein have been found for this gene. Other transcript variants may exist, but have not been fully characterized yet. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein, Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - ganglio series, Glycosphingolipid biosynthesis - globo series, Keratan sulfate biosynthesis, Metabolic pathways, O-Glycan biosynthesis