Prostaglandin D Synthase (PTGDS) (NM_000954) Human Mass Spec Standard
CAT#: PH316795
PTGDS MS Standard C13 and N15-labeled recombinant protein (NP_000945)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216795 |
Predicted MW | 20.8 kDa |
Protein Sequence |
>RC216795 representing NM_000954
Red=Cloning site Green=Tags(s) MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVA PATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPG EDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000945 |
RefSeq Size | 837 |
RefSeq ORF | 570 |
Synonyms | L-PGDS; LPGDS; PDS; PGD2; PGDS; PGDS2 |
Locus ID | 5730 |
UniProt ID | P41222, A0A024R8G3 |
Cytogenetics | 9q34.3 |
Summary | The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. This gene is preferentially expressed in brain. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement sleep. [provided by RefSeq, Jul 2008] |
Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400343 | PTGDS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400343 | Transient overexpression lysate of prostaglandin D2 synthase 21kDa (brain) (PTGDS) |
USD 436.00 |
|
TP316795 | Recombinant protein of human prostaglandin D2 synthase 21kDa (brain) (PTGDS), 20 µg |
USD 867.00 |
|
TP720757 | Purified recombinant protein of Human prostaglandin D2 synthase 21kDa (brain) (PTGDS) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review