ASB3 (NM_016115) Human Mass Spec Standard
CAT#: PH316743
ASB3 MS Standard C13 and N15-labeled recombinant protein (NP_057199)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216743 |
Predicted MW | 57.6 kDa |
Protein Sequence |
>RC216743 representing NM_016115
Red=Cloning site Green=Tags(s) MDFTEAYADTCSTVGLAAREGNVKVLRKLLKKGRSVDVADNRGWMPIHEAAYHNSVECLQMLINADSSEN YIKMKTFEGFCALHLAASQGHWKIVQILLEAGADPNATTLEETTPLFLAVENGQIDVLRLLLQHGANVNG SHSMCGWNSLHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQAL DKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNK VSPVYSAVFGGHEDCLEILLRNGYSPDAQACLVFGFSSPVCMAFQKDCEFFGIVNILLKYGAQINELHLA YCLKYEKFSIFRYFLRKGCSLGPWNHIYEFVNHAIKAQAKYKEWLPHLLVAGFDPLILLCNSWIDSVSID TLIFTLEFTNWKTLAPAVERMLSARASNAWILQQHIATVPSLTHLCRLEIRSSLKSERLRSDSYISQLPL PRSLHNYLLYEDVLRMYEVPELAAIQDG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057199 |
RefSeq Size | 2214 |
RefSeq ORF | 1554 |
Synonyms | ASB-3 |
Locus ID | 51130 |
UniProt ID | Q9Y575 |
Cytogenetics | 2p16.2 |
Summary | The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402502 | ASB3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407847 | ASB3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402502 | Transient overexpression lysate of ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 1 |
USD 436.00 |
|
LY407847 | Transient overexpression lysate of ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 2 |
USD 436.00 |
|
PH302814 | ASB3 MS Standard C13 and N15-labeled recombinant protein (NP_665862) |
USD 3,255.00 |
|
TP302814 | Recombinant protein of human ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 2, 20 µg |
USD 867.00 |
|
TP316743 | Recombinant protein of human ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review