HEY1 (NM_001040708) Human Mass Spec Standard

CAT#: PH316696

HEY1 MS Standard C13 and N15-labeled recombinant protein (NP_001035798)

Product Images

Coomassie blue staining of purified HEY1 protein (Cat# TP316696). The protein was produced from HEK293T cells transfected with HEY1 cDNA clone (Cat# RC216696) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216696
• Predicted MW: 32.9 kDa
• Protein Sequence:
  Sequence Link

  >RC216696 representing NM_001040708
  Red=Cloning site Green=Tags(s)
  
  MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLS
  ELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVAR
  YLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGT
  TASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLYP
  NALSPSAPTQAANLGKPYRPWGTEIGAF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035798
• RefSeq Size: 2331
• RefSeq ORF: 924
• Synonyms: BHLHb31; CHF2; HERP2; HESR1; hHRT1; HRT-1; NERP2; OAF1
• Locus ID: 23462
• UniProt ID: Q9Y5J3
• Cytogenetics: 8q21.13
• Summary: This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors