SPRR2A (NM_005988) Human Mass Spec Standard

CAT#: PH315197

SPRR2A MS Standard C13 and N15-labeled recombinant protein (NP_005979)

Product Images

Coomassie blue staining of purified SPRR2A protein (Cat# TP315197). The protein was produced from HEK293T cells transfected with SPRR2A cDNA clone (Cat# RC215197) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215197
• Predicted MW: 8 kDa
• Protein Sequence:
  Sequence Link

  >RC215197 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPK
  SK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005979
• RefSeq Size: 692
• RefSeq ORF: 216
• Locus ID: 6700
• UniProt ID: P35326
• Cytogenetics: 1q21.3
• Summary: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.[UniProtKB/Swiss-Prot Function]