GAGE13 (NM_001098412) Human Mass Spec Standard

CAT#: PH313979

GAGE13 MS Standard C13 and N15-labeled recombinant protein (NP_001091882)

Product Images

Coomassie blue staining of purified GAGE13 protein (Cat# TP313979). The protein was produced from HEK293T cells transfected with GAGE13 cDNA clone (Cat# RC213979) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213979
• Predicted MW: 12.7 kDa
• Protein Sequence:
  Sequence Link

  >RC213979 representing NM_001098412
  Red=Cloning site Green=Tags(s)
  
  MSWRGRSTYYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGP
  KPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGKKQSQC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001091882
• RefSeq Size: 527
• RefSeq ORF: 351
• Synonyms: GAGE-12A; GAGE-13; GAGE12A
• Locus ID: 645051
• UniProt ID: Q4V321
• Cytogenetics: Xp11.23