ZIP Kinase (DAPK3) (NM_001348) Human Mass Spec Standard

CAT#: PH313427

DAPK3 MS Standard C13 and N15-labeled recombinant protein (NP_001339)

Product Images

Coomassie blue staining of purified DAPK3 protein (Cat# TP313427). The protein was produced from HEK293T cells transfected with DAPK3 cDNA clone (Cat# RC213427) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213427
• Predicted MW: 52.4 kDa
• Protein Sequence:
  Sequence Link

  >RC213427 representing NM_001348
  Red=Cloning site Green=Tags(s)
  
  MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILRE
  IRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDL
  KPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL
  LSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRR
  RNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCH
  EDVEALAAIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
  EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR
  
  LEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001339
• RefSeq Size: 2105
• RefSeq ORF: 1362
• Synonyms: DLK; ZIP; ZIPK
• Locus ID: 1613
• UniProt ID: O43293, B3KNJ3
• Cytogenetics: 19p13.3
• Summary: Death-associated protein kinase 3 (DAPK3) induces morphological changes in apoptosis when overexpressed in mammalian cells. These results suggest that DAPK3 may play a role in the induction of apoptosis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Bladder cancer, Pathways in cancer