C9orf21 (AAED1) (NM_153698) Human Mass Spec Standard

CAT#: PH313257

C9orf21 MS Standard C13 and N15-labeled recombinant protein (NP_714542)

Product Images

Coomassie blue staining of purified PRXL2C protein (Cat# TP313257). The protein was produced from HEK293T cells transfected with PRXL2C cDNA clone (Cat# RC213257) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213257
• Predicted MW: 24.7 kDa
• Protein Sequence:
  Sequence Link

  >RC213257 representing NM_153698
  Red=Cloning site Green=Tags(s)
  
  MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYI
  CKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASS
  GQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLV
  GVQHVNFTNRPSVIHV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_714542
• RefSeq Size: 1242
• RefSeq ORF: 678
• Synonyms: AAED1; C9orf21
• Locus ID: 195827
• UniProt ID: Q7RTV5
• Cytogenetics: 9q22.33
• Summary: May regulate positively ERK1/2 signaling and AKT1 activation leading to HIF1A up-regulation with an increased expression of glycolysis genes and enhanced glycolysis.[UniProtKB/Swiss-Prot Function]