FAM92A1 (FAM92A) (NM_145269) Human Mass Spec Standard

CAT#: PH312680

FAM92A1 MS Standard C13 and N15-labeled recombinant protein (NP_660312)

Product Images

Coomassie blue staining of purified FAM92A protein (Cat# TP312680). The protein was produced from HEK293T cells transfected with FAM92A cDNA clone (Cat# RC212680) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212680
• Predicted MW: 33.3 kDa
• Protein Sequence:
  Sequence Link

  >RC212680 representing NM_145269
  Red=Cloning site Green=Tags(s)
  
  MMRRTLENRNAQTKQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAATETPHLKLGL
  MNFADEFAKLQDYRQAEVERLEAKVVEPLKTYGTIVKMKRDDLKATLTARNREAKQLTQLERTRQRNPSD
  RHVISQAETELQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNIQ
  NIDEDEDLEVFRNSLYAPDYSSRLDIVRANSKSPLQRSLSAKCVSGTGQVSTCRLRKDQQAEDDEDDELD
  VTEEENFLK
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660312
• RefSeq Size: 1135
• RefSeq ORF: 867
• Synonyms: FAM92A; FAM92A1; PAPA9
• Locus ID: 137392
• UniProt ID: A1XBS5
• Cytogenetics: 8q22.1
• Summary: Probable regulator of ciliogenesis involved in limb morphogenesis. In cooperation with CBY1 it is involved in the recruitment and fusion of endosomal vesicles at distal appendages during early stages of ciliogenesis.[UniProtKB/Swiss-Prot Function]