C2orf60 (TYW5) (NM_001039693) Human Mass Spec Standard

SKU
PH312399
C2orf60 MS Standard C13 and N15-labeled recombinant protein (NP_001034782)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212399]
Predicted MW 36.5 kDa
Protein Sequence
Protein Sequence
>RC212399 protein sequence
Red=Cloning site Green=Tags(s)

MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDF
ISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKE
EQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPL
FSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILD
RALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034782
RefSeq Size 5384
RefSeq ORF 945
Synonyms C2orf60; hTYW5
Locus ID 129450
UniProt ID A2RUC4
Cytogenetics 2q33.1
Summary tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C2orf60 (TYW5) (NM_001039693) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421890 TYW5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421890 Transient overexpression lysate of chromosome 2 open reading frame 60 (C2orf60), transcript variant 1 100 ug
$436.00
TP312399 Recombinant protein of human chromosome 2 open reading frame 60 (C2orf60), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.