SKIP (INPP5K) (NM_130766) Human Mass Spec Standard
CAT#: PH312090
INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_570122)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212090 |
Predicted MW | 51.1 kDa |
Protein Sequence |
>RC212090 protein sequence
Red=Cloning site Green=Tags(s) MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFND SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIK NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR SVVGISRPFQIPPGSLREDPLGEAQPQI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_570122 |
RefSeq Size | 3232 |
RefSeq ORF | 1347 |
Synonyms | MDCCAID; PPS; SKIP |
Locus ID | 51763 |
UniProt ID | Q9BT40, Q9BT40-2 |
Cytogenetics | 17p13.3 |
Summary | This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Inositol phosphate metabolism, Insulin signaling pathway, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402561 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC408929 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427643 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402561 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1 |
USD 436.00 |
|
LY408929 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2 |
USD 436.00 |
|
LY427643 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3 |
USD 436.00 |
|
PH300092 | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_057616) |
USD 3,255.00 |
|
PH327852 | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_001129114) |
USD 3,255.00 |
|
TP300092 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, 20 µg |
USD 867.00 |
|
TP312090 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, 20 µg |
USD 867.00 |
|
TP327852 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review