RAB12 (NM_001025300) Human Mass Spec Standard

CAT#: PH311472

RAB12 MS Standard C13 and N15-labeled recombinant protein (NP_001020471)

Product Images

Coomassie blue staining of purified RAB12 protein (Cat# TP311472). The protein was produced from HEK293T cells transfected with RAB12 cDNA clone (Cat# RC211472) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211472
• Predicted MW: 27.1 kDa
• Protein Sequence:
  Sequence Link

  >RC211472 representing NM_001025300
  Red=Cloning site Green=Tags(s)
  
  MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEA
  CKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMI
  DKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPL
  DILRNELSNSILSLQPEPEIPPELPPPRPHVRCC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001020471
• RefSeq Size: 2138
• RefSeq ORF: 732
• Locus ID: 201475
• UniProt ID: Q6IQ22
• Cytogenetics: 18p11.22
• Summary: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab may play a role in protein transport from recycling endosomes to lysosomes regulating, for instance, the degradation of the transferrin receptor. Involved in autophagy (By similarity).[UniProtKB/Swiss-Prot Function]