STARS (ABRA) (NM_139166) Human Mass Spec Standard

CAT#: PH311264

ABRA MS Standard C13 and N15-labeled recombinant protein (NP_631905)

Product Images

Coomassie blue staining of purified ABRA protein (Cat# TP311264). The protein was produced from HEK293T cells transfected with ABRA cDNA clone (Cat# RC211264) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211264
• Predicted MW: 43.1 kDa
• Protein Sequence:
  Sequence Link

  >RC211264 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPGEKESGEGPAKSALRKIRTATLVISLARGWQQWANENSIRQAQEPTGWLPGGTQDSPQAPKPITPPT
  SHQKAQSAPKSPPRLPEGHGDGQSSEKAPEVSHIKKKEVSKTVVSKTYERGGDVSHLSHRYERDAGVLEP
  GQPENDIDRILHSHGSPTRRRKCANLVSELTKGWRVMEQEEPTWRSDSVDTEDSGYGGEAEERPEQDGVQ
  VAVVRIKRPLPSQVNRFTEKLNCKAQQKYSPVGNLKGRWQQWADEHIQSQKLNPFSEEFDYELAMSTRLH
  KGDEGYGRPKEGTKTAERAKRAEEHIYREMMDMCFIICTMARHRRDGKIQVTFGDLFDRYVRISDKVVGI
  LMRARKHGLVDFEGEMLWQGRDDHVVITLLK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_631905
• RefSeq Size: 2831
• RefSeq ORF: 1143
• Synonyms: STARS
• Locus ID: 137735
• UniProt ID: Q8N0Z2
• Cytogenetics: 8q23.1
• Summary: Acts as an activator of serum response factor (SRF)-dependent transcription possibly by inducing nuclear translocation of MKL1 or MKL2 and through a mechanism requiring Rho-actin signaling.[UniProtKB/Swiss-Prot Function]