OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PVRL1 (NECTIN1) (NM_002855) Human Mass Spec Standard

Be the first to review this product
SKU
PH311214
PVRL1 MS Standard C13 and N15-labeled recombinant protein (NP_002846)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503521 PVRL1 mouse monoclonal antibody, clone OTI6F8 (formerly 6F8) 100 ul
$447.00
LY404370 Transient overexpression lysate of poliovirus receptor-related 1 (herpesvirus entry mediator C) (PVRL1), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "PVRL1 or NM_002855"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211214
Predicted MW 57.2 kDa
Protein Sequence
Protein Sequence
>RC211214 protein sequence
Red=Cloning site Green=Tags(s)

MARMGLAGAAGRWWGLALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKS
TNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNL
TVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWETRLKGEAEYQEIRNPNGTVTVISR
YRLVPSREAHQQSLACIVNYHMDRFKESLTLNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEY
HWTTLNGSLPKGVEAQNRTLFFKGPINYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPSPPEHGRRAG
PVPTAIIGGVAGSILLVLIVVGGIVVALRRRRHTFKGDYSTKKHVYGNGYSKAGIPQHHPPMAQNLQYPD
DSDDEKKAGPLGGSSYEEEEEEEEGGGGGERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYGDRTLGYQY
DPEQLDLAENMVSQNDGSFISKKEWYV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002846
RefSeq Size 5493
RefSeq ORF 1551
Synonyms CD111; CLPED1; ED4; HIgR; HV1S; HVEC; nectin-1; OFC7; PRR; PRR1; PVRL1; PVRR; PVRR1; SK-12
Locus ID 5818
UniProt ID Q15223
Cytogenetics 11q23.3
Summary This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobulin superfamily and has 3 extracellular immunoglobulin-like loops, a single transmembrane domain (in some isoforms), and a cytoplasmic region. This protein acts as a receptor for glycoprotein D (gD) of herpes simplex viruses 1 and 2 (HSV-1, HSV-2), and pseudorabies virus (PRV) and mediates viral entry into epithelial and neuronal cells. Mutations in this gene cause cleft lip and palate/ectodermal dysplasia 1 syndrome (CLPED1) as well as non-syndromic cleft lip with or without cleft palate (CL/P). Alternative splicing results in multiple transcript variants encoding proteins with distinct C-termini. provided by RefSeq, Oct 2009
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Adherens junction, Cell adhesion molecules (CAMs)
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PVRL1" proteins (6)
SKU Description Size Price
LC404370 Lyophilized PVRL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419083 Lyophilized PVRL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404370 Transient overexpression lysate of poliovirus receptor-related 1 (herpesvirus entry mediator C) (PVRL1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY419083 Transient overexpression lysate of poliovirus receptor-related 1 (herpesvirus entry mediator C) (PVRL1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP311214 Recombinant protein of human poliovirus receptor-related 1 (herpesvirus entry mediator C) (PVRL1), transcript variant 1, 20 µg 20 ug
$737.00
TP720410 Purified recombinant protein of Homo sapiens poliovirus receptor-related 1 (herpesvirus entry mediator C) (PVRL1), transcript variant 1 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products