Apolipoprotein A V (APOA5) (NM_052968) Human Mass Spec Standard
CAT#: PH311023
APOA5 MS Standard C13 and N15-labeled recombinant protein (NP_443200)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211023 |
Predicted MW | 41.2 kDa |
Protein Sequence |
>RC211023 protein sequence
Red=Cloning site Green=Tags(s) MASMAAVLTWALALLSAFSATQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSLEQDLNNMNKF LEKLRPLSGSEAPRLPQDPVGMRRQLQEELEEVKARLQPYMAEAHELVGWNLEGLRQQLKPYTMDLMEQV ALRVQELQEQLRVVGEDTKAQLLGGVDEAWALLQGLQSRVVHHTGRFKELFHPYAESLVSGIGRHVQELH RSVAPHAPASPARLSRCVQVLSRKLTLKAKALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEE VRQRLQAFRQDTYLQIAAFTRAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWED ITHSLHDQGHSHLGDP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_443200 |
RefSeq Size | 1954 |
RefSeq ORF | 1098 |
Synonyms | APOAV; RAP3 |
Locus ID | 116519 |
UniProt ID | Q6Q788, A0A0B4RUS7 |
Cytogenetics | 11q23.3 |
Summary | The protein encoded by this gene is an apolipoprotein that plays an important role in regulating the plasma triglyceride levels, a major risk factor for coronary artery disease. It is a component of high density lipoprotein and is highly similar to a rat protein that is upregulated in response to liver injury. Mutations in this gene have been associated with hypertriglyceridemia and hyperlipoproteinemia type 5. This gene is located proximal to the apolipoprotein gene cluster on chromosome 11q23. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403279 | APOA5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403279 | Transient overexpression lysate of apolipoprotein A-V (APOA5), transcript variant 1 |
USD 436.00 |
|
TP311023 | Recombinant protein of human apolipoprotein A-V (APOA5), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review