CSPS (SULT1A3) (NM_003166) Human Mass Spec Standard

SKU PH310772

SULT1A3 MS Standard C13 and N15-labeled recombinant protein (NP_003157)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210772]
• Predicted MW: 34.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC210772 protein sequence; Red=Cloning site Green=Tags(s); ; MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKC; NRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYY; HFHRMEKAHPEPGTWDSFLEKFMAGEVSYWSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF; VGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY; AEKMAGCSLSFRSEL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003157
• RefSeq Size: 1604
• RefSeq ORF: 885
• Synonyms: HAST; HAST3; M-PST; MGC117469; ST1A5; STM; SULT1A4; TL-PST
• Locus ID: 6818
• UniProt ID: P50224
• Cytogenetics: 16p11.2
• Summary: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Read-through transcription exists between this gene and the upstream SLX1A (SLX1 structure-specific endonuclease subunit homolog A) gene that encodes a protein containing GIY-YIG domains. [provided by RefSeq, Nov 2010]
• Protein Pathways: Sulfur metabolism