WW domain binding protein 4 (WBP4) (NM_007187) Human Mass Spec Standard

CAT#: PH310721

WBP4 MS Standard C13 and N15-labeled recombinant protein (NP_009118)

Product Images

Coomassie blue staining of purified WBP4 protein (Cat# TP310721). The protein was produced from HEK293T cells transfected with WBP4 cDNA clone (Cat# RC210721) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210721
• Predicted MW: 42.5 kDa
• Protein Sequence:
  Sequence Link

  >RC210721 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEA
  AALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYY
  YDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIPHTSDLPSSKVN
  ENSLGTLDESKSSDSHSDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGS
  NEEKSKTLKKSNPYGEWQEIKQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMAD
  GVAPVFKKRRTENGKSRNLRQRGDDQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009118
• RefSeq Size: 2354
• RefSeq ORF: 1128
• Synonyms: FBP21
• Locus ID: 11193
• UniProt ID: O75554
• Cytogenetics: 13q14.11
• Summary: This gene encodes WW domain-containing binding protein 4. The WW domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron bridging of U1 and U2 snRNPs in the spliceosomal complex A. [provided by RefSeq, Jul 2008]