OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFNA21 (NM_002175) Human Mass Spec Standard

Be the first to review this product
SKU
PH310115
IFNA21 MS Standard C13 and N15-labeled recombinant protein (NP_002166)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY419491 Transient overexpression lysate of interferon, alpha 21 (IFNA21) (as WB positive control)
100 ug
$436.00

Other products for "IFNA21 or NM_002175"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210115
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC210115 protein sequence
Red=Cloning site Green=Tags(s)

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQ
FQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSI
LAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002166
RefSeq Size 1024
RefSeq ORF 567
Synonyms IFN-alphaI; leIF-F; LeIF F
Locus ID 3452
UniProt ID P01568
Cytogenetics 9p21.3
Summary This gene is a member of the alpha interferon gene cluster on the short arm of chromosome 9. Interferons are cytokines produced in response to viral infection that mediate the immune response and interfere with viral replication. The encoded protein is a type I interferon and may play a specific role in the antiviral response to rubella virus. provided by RefSeq, Sep 2011
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFNA21" proteins (3)
SKU Description Size Price
LC419491 Lyophilized IFNA21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419491 Transient overexpression lysate of interferon, alpha 21 (IFNA21) (as WB positive control) 100 ug
$436.00
TP310115 Recombinant protein of human interferon, alpha 21 (IFNA21), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products