HGD (NM_000187) Human Mass Spec Standard

CAT#: PH310009

HGD MS Standard C13 and N15-labeled recombinant protein (NP_000178)

Product Images

Coomassie blue staining of purified HGD protein (Cat# TP310009). The protein was produced from HEK293T cells transfected with HGD cDNA clone (Cat# RC210009) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210009
• Predicted MW: 50 kDa
• Protein Sequence:
  Sequence Link

  >RC210009 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSH
  KPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNT
  SMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFEL
  PDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLK
  NFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHY
  EAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLD
  ENYHKCWEPLKSHFTPNSRNPAEPN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000178
• RefSeq Size: 2012
• RefSeq ORF: 1335
• Synonyms: AKU; HGO
• Locus ID: 3081
• UniProt ID: Q93099
• Cytogenetics: 3q13.33
• Summary: This gene encodes the enzyme homogentisate 1,2 dioxygenase. This enzyme is involved in the catabolism of the amino acids tyrosine and phenylalanine. Mutations in this gene are the cause of the autosomal recessive metabolism disorder alkaptonuria.[provided by RefSeq, May 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Tyrosine metabolism