Amisyn (STXBP6) (NM_014178) Human Mass Spec Standard

CAT#: PH309598

STXBP6 MS Standard C13 and N15-labeled recombinant protein (NP_054897)

Product Images

Coomassie blue staining of purified STXBP6 protein (Cat# TP309598). The protein was produced from HEK293T cells transfected with STXBP6 cDNA clone (Cat# RC209598) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209598
• Predicted MW: 23.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209598 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAKSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTNKKPTQASITKVKQFEG
  STSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPE
  FINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLKNSAQQFAETAHKLAMKHKC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054897
• RefSeq Size: 1970
• RefSeq ORF: 630
• Synonyms: amisyn; HSPC156
• Locus ID: 29091
• UniProt ID: Q8NFX7
• Cytogenetics: 14q12
• Summary: STXBP6 binds components of the SNARE complex (see MIM 603215) and may be involved in regulating SNARE complex formation (Scales et al., 2002 [PubMed 12145319]).[supplied by OMIM, Mar 2008]