ELK4 (NM_021795) Human Mass Spec Standard

SKU
PH309572
ELK4 MS Standard C13 and N15-labeled recombinant protein (NP_068567)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209572]
Predicted MW 44.7 kDa
Protein Sequence
Protein Sequence
>RC209572 protein sequence
Red=Cloning site Green=Tags(s)

MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKN
IIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRND
YIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISI
GPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDT
DIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPT
ASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068567
RefSeq Size 3077
RefSeq ORF 1215
Synonyms SAP1
Locus ID 2005
UniProt ID P28324
Cytogenetics 1q32.1
Summary This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways MAPK signaling pathway
Write Your Own Review
You're reviewing:ELK4 (NM_021795) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411912 ELK4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419619 ELK4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411912 Transient overexpression lysate of ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant b 100 ug
$436.00
LY419619 Transient overexpression lysate of ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant a 100 ug
$665.00
TP309572 Recombinant protein of human ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant b, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760364 Purified recombinant protein of Human ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant a, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.