MEAK7 (TLDC1) (NM_020947) Human Mass Spec Standard

SKU
PH309287
KIAA1609 MS Standard C13 and N15-labeled recombinant protein (NP_065998)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209287]
Predicted MW 51 kDa
Protein Sequence
Protein Sequence
>RC209287 protein sequence
Red=Cloning site Green=Tags(s)

MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKALQNHVGEALPPEMVTRLYDGM
RRVDLTGKAKGPSENVSQEQFTASMSHLLKGNSEEKSLMIMKMISATEGPVKAREVQKFTEDLVGSVVHV
LSHRQELRGWTGKEAPGPNPRVQVLAAQLLSDMKLQDGKRLLGPQWLDYDCDRAVIEDWVFRVPHVAIFL
SVVICKGFLVLCSSLDLTTLVPERQVDQGRGFESILDVLSVMYINAQLPREQRHRWRLLFSSELHGHSFS
QLCGHITHRGPCVAVLEDHDKHVFGGFASCSWEVKPQFQGDNRCFLFSICPSMAVYTHTGYNDHYMYLNH
GQQTIPNGLGMGGQHNYFGLWVDVDFGKGHSRAKPTCTTYNSPQLSAQENFQFDKMEVWAVGDPSEEQLA
KGNKSILDADPEAQALLEISGHSRHSEGLREVPDDE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065998
RefSeq Size 5031
RefSeq ORF 1368
Synonyms KIAA1609; mEAK-7; TLDC1
Locus ID 57707
UniProt ID Q6P9B6
Cytogenetics 16q24.1
Summary Activates an alternative mTOR signaling through RPS6KB2 activation and EIF4EBP1 repression to regulate cell proliferation and migration (PubMed:29750193). Recruits MTOR at the lysosome, essential for MTOR signaling at the lysosome (PubMed:29750193).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MEAK7 (TLDC1) (NM_020947) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402813 TLDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402813 Transient overexpression lysate of KIAA1609 (KIAA1609) 100 ug
$436.00
TP309287 Recombinant protein of human KIAA1609 (KIAA1609), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.